RetrogeneDB ID: | retro_mdom_609 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:518507786..518507954(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000025472 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.66 % |
| Parental protein coverage: | 74.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TYFYPCPCGDNFIITKEDLENGEEVATCPSCSLVIKVIYDRDQFMCGETVSVPPTSKELVK |
| T..YPC..G.....TKE..ENG...A.CPSCS..IKVI.D.D.FMC.ETVSVP..SK.LVK | |
| Retrocopy | TFPYPCLYGS---FTKE--ENGVQMASCPSCSPGIKVICDQDKFMCRETVSVPLRSKDLVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |