RetrogeneDB ID: | retro_nleu_2876 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397458.1:2048740..2048974(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPH3 | ||
Ensembl ID: | ENSNLEG00000001096 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.13 % |
Parental protein coverage: | 91.46 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VEIEDFQYDEDSETYFYPCPCGDNFSI---TKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPS |
VEI....YD.D....FYPC.C.DN..........LENG.D..TCPSC.LIIKVI.DKDQ..C.ET.PAP. | |
Retrocopy | VEIMHLLYDNDLKMHFYPCTCRDNLYVHLHSRQELENGKDMGTCPSCFLIIKVIDDKDQHMCRETDPAPF |
Parental | ANKELVKC |
.N...VKC | |
Retrocopy | TNR*FVKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Homo sapiens | ENSG00000154813 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies |
retro_nleu_2876 , retro_nleu_2913,
|
Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |