RetrogeneDB ID: | retro_nleu_2913 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397482.1:215336..215577(+) | ||
| Located in intron of: | ENSNLEG00000009946 | ||
Retrocopy information | Ensembl ID: | ENSNLEG00000009952 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DPH3 | ||
| Ensembl ID: | ENSNLEG00000001096 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.13 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAVFHDEVEIEDFQYDEDSETYFY-PCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGET |
| MAVFHDEVEIEDFQY..D.....Y.PCPCGDNFSITKE.LENGE.VA.CPSCSLIIKVIYDKDQF.CGET | |
| Retrocopy | MAVFHDEVEIEDFQY--DEDSETY>PCPCGDNFSITKEELENGEGVAMCPSCSLIIKVIYDKDQFACGET |
| Parental | VPAPSANKELVKC |
| VP.PSANKE.VKC | |
| Retrocopy | VPVPSANKE*VKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
| Homo sapiens | ENSG00000154813 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies |
retro_nleu_2876, retro_nleu_2913 ,
|
| Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |