RetrogeneDB ID: | retro_ptro_1409 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 20:60228521..60228767(+) | ||
Located in intron of: | ENSPTRG00000013720 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPH3 | ||
Ensembl ID: | ENSPTRG00000014671 | ||
Aliases: | None | ||
Description: | diphthamide biosynthesis 3 [Source:HGNC Symbol;Acc:27717] |
Percent Identity: | 87.8 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIVKVIYDKDQFVCGETV |
MAVFHDEVEIEDFQYDEDSETYF.PCPCGDNFSITKE.LENGE.VA.CP.CSLI.KVIYDKDQF.CGETV | |
Retrocopy | MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETV |
Parental | PAPSANKELVKC |
P.PS.NKE.VKC | |
Retrocopy | PVPSVNKE*VKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .77 RPM | 4 .95 RPM |
SRP007412_cerebellum | 0 .32 RPM | 5 .27 RPM |
SRP007412_heart | 0 .85 RPM | 6 .82 RPM |
SRP007412_kidney | 0 .65 RPM | 6 .07 RPM |
SRP007412_liver | 0 .16 RPM | 5 .14 RPM |
SRP007412_testis | 0 .42 RPM | 9 .70 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2438 |
Gorilla gorilla | retro_ggor_174 |
Pongo abelii | retro_pabe_1795 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Homo sapiens | ENSG00000154813 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy |
retro_ptro_1409 ,
|
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |