RetrogeneDB ID: | retro_mmul_2085 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 6:62014498..62014692(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.1733 | ||
Ensembl ID: | ENSMMUG00000022692 | ||
Aliases: | ZCSL2, DPH3 | ||
Description: | DPH3, KTI11 homolog [Source:RefSeq peptide;Acc:NP_001247449] |
Percent Identity: | 51.52 % |
Parental protein coverage: | 79.27 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | EDSETYFYPCPCGDNFSITKEDLENG-EDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK |
E........CP.GD..SITKE.LEN..E.V...P..S..IKVIY..D.F.CG..VPA....KELVK | |
Retrocopy | EITDVFSHHCPYGDYLSITKEKLENK<ESVEMNPG*SFFIKVIYNTDKFICG*IVPALVTTKELVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 39 .55 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .62 RPM |
SRP007412_cerebellum | 0 .06 RPM | 31 .12 RPM |
SRP007412_heart | 0 .00 RPM | 31 .09 RPM |
SRP007412_kidney | 0 .00 RPM | 30 .52 RPM |
SRP007412_liver | 0 .00 RPM | 17 .54 RPM |
SRP007412_testis | 0 .08 RPM | 32 .98 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Homo sapiens | ENSG00000154813 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies |
retro_mmul_2085 , retro_mmul_497,
|
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |