RetrogeneDB ID: | retro_mmul_2085 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:62014498..62014692(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.1733 | ||
| Ensembl ID: | ENSMMUG00000022692 | ||
| Aliases: | ZCSL2, DPH3 | ||
| Description: | DPH3, KTI11 homolog [Source:RefSeq peptide;Acc:NP_001247449] |
| Percent Identity: | 51.52 % |
| Parental protein coverage: | 79.27 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | EDSETYFYPCPCGDNFSITKEDLENG-EDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK |
| E........CP.GD..SITKE.LEN..E.V...P..S..IKVIY..D.F.CG..VPA....KELVK | |
| Retrocopy | EITDVFSHHCPYGDYLSITKEKLENK<ESVEMNPG*SFFIKVIYNTDKFICG*IVPALVTTKELVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 39 .55 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .62 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 31 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 31 .09 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .52 RPM |
| SRP007412_liver | 0 .00 RPM | 17 .54 RPM |
| SRP007412_testis | 0 .08 RPM | 32 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
| Homo sapiens | ENSG00000154813 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies |
retro_mmul_2085 , retro_mmul_497,
|
| Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |