RetrogeneDB ID: | retro_pabe_1795 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 20:61207825..61208068(+) | ||
| Located in intron of: | ENSPPYG00000011219 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DPH3 | ||
| Ensembl ID: | ENSPPYG00000014083 | ||
| Aliases: | None | ||
| Description: | DPH3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5R7N8] |
| Percent Identity: | 86.59 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV |
| MAVFH..VEIEDFQYDEDSETYF.PCP.GDNFSITKE.LENGE.VA.CP.CSLIIKVIYDKDQF.CGETV | |
| Retrocopy | MAVFHG-VEIEDFQYDEDSETYFCPCPSGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETV |
| Parental | PAPSANKELVKC |
| P.PSANKE.VKC | |
| Retrocopy | PVPSANKE*VKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .17 RPM | 13 .49 RPM |
| SRP007412_cerebellum | 0 .24 RPM | 19 .33 RPM |
| SRP007412_heart | 0 .24 RPM | 14 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .77 RPM |
| SRP007412_liver | 0 .12 RPM | 16 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2438 |
| Pan troglodytes | retro_ptro_1409 |
| Gorilla gorilla | retro_ggor_174 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
| Homo sapiens | ENSG00000154813 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014083 | 1 retrocopy |
retro_pabe_1795 ,
|
| Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |