RetrogeneDB ID: | retro_pabe_1795 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 20:61207825..61208068(+) | ||
Located in intron of: | ENSPPYG00000011219 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPH3 | ||
Ensembl ID: | ENSPPYG00000014083 | ||
Aliases: | None | ||
Description: | DPH3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5R7N8] |
Percent Identity: | 86.59 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV |
MAVFH..VEIEDFQYDEDSETYF.PCP.GDNFSITKE.LENGE.VA.CP.CSLIIKVIYDKDQF.CGETV | |
Retrocopy | MAVFHG-VEIEDFQYDEDSETYFCPCPSGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETV |
Parental | PAPSANKELVKC |
P.PSANKE.VKC | |
Retrocopy | PVPSANKE*VKC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .17 RPM | 13 .49 RPM |
SRP007412_cerebellum | 0 .24 RPM | 19 .33 RPM |
SRP007412_heart | 0 .24 RPM | 14 .06 RPM |
SRP007412_kidney | 0 .00 RPM | 11 .77 RPM |
SRP007412_liver | 0 .12 RPM | 16 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2438 |
Pan troglodytes | retro_ptro_1409 |
Gorilla gorilla | retro_ggor_174 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Homo sapiens | ENSG00000154813 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014083 | 1 retrocopy |
retro_pabe_1795 ,
|
Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |