RetrogeneDB ID: | retro_mdom_719 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:219182258..219182579(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL20 | ||
Ensembl ID: | ENSMODG00000006562 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L20 [Source:HGNC Symbol;Acc:14478] |
Percent Identity: | 57.27 % |
Parental protein coverage: | 73.83 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | FRGRKNRCHRLAVRTETSAFVKCSKARRLKKKNMRTLWINRITAASQEHGLKYPSFISNLVKCQVELNRK |
F.GRKN.C..LA.........KC..ARR.KK.NM.TLWIN.I..AS.EH.LKYPSFISNL..C.VEL.RK | |
Retrocopy | FGGRKNWCFKLAIGDVNGVLAKCVYARRIKK-NMKTLWINGIKPAS*EHSLKYPSFISNL--CHVELSRK |
Parental | VLADLAIYEPKTFKSLAALAKRRREEGFAAALGDEKEPAG |
VLA.L..YE.KT..SLA.L.KRR.EE..A.......E..G | |
Retrocopy | VLAYLVTYEFKTLTSLATLTKRRKEESLATDIFEI*ERVG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013932 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000019259 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010105 | 1 retrocopy | |
Homo sapiens | ENSG00000242485 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027251 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011857 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000006562 | 2 retrocopies |
retro_mdom_1424, retro_mdom_719 ,
|
Mus musculus | ENSMUSG00000029066 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000005968 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000001425 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000008735 | 2 retrocopies |