RetrogeneDB ID: | retro_mmul_1038 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 13:85658069..85658346(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.12924 | ||
Ensembl ID: | ENSMMUG00000023126 | ||
Aliases: | None | ||
Description: | U6 snRNA-associated Sm-like protein LSm3 [Source:RefSeq peptide;Acc:NP_001248293] |
Percent Identity: | 83.87 % |
Parental protein coverage: | 90.2 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | TNTVEEPLDLIRLSLDERIYVKMRNDRELRGRL-HAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTK |
TNTVEEPLD.IRLSLDE.IYVKMRND.E..GRL.HAYDQHLNM.LGDVEETVTT..IDEETYEEIYKS.K | |
Retrocopy | TNTVEEPLDFIRLSLDELIYVKMRNDQEF*GRL>HAYDQHLNMTLGDVEETVTTVDIDEETYEEIYKSMK |
Parental | RNIPMLFVRGDGVVLVAPPLRVG |
.NIP.LFV.GD..VLVAPPLRVG | |
Retrocopy | *NIPVLFVQGDVIVLVAPPLRVG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 10 .31 RPM |
SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 7 .93 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .88 RPM |
SRP007412_heart | 0 .00 RPM | 13 .13 RPM |
SRP007412_kidney | 0 .00 RPM | 30 .05 RPM |
SRP007412_liver | 0 .00 RPM | 10 .25 RPM |
SRP007412_testis | 0 .00 RPM | 56 .99 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2286 |
Pan troglodytes | retro_ptro_1619 |
Gorilla gorilla | retro_ggor_1699 |
Pongo abelii | retro_pabe_1936 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000007363 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016977 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000006671 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018032 | 7 retrocopies | |
Echinops telfairi | ENSETEG00000016207 | 8 retrocopies | |
Homo sapiens | ENSG00000170860 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000023308 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000023126 | 5 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011088 | 1 retrocopy | |
Oreochromis niloticus | ENSONIG00000000370 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013402 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014650 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000008733 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011601 | 6 retrocopies | |
Tursiops truncatus | ENSTTRG00000011197 | 1 retrocopy |