RetrogeneDB ID: | retro_sscr_457 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 15:40842938..40843178(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000011601 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 78.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | LSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGV |
| L...E.IYVKMRNDREL.G.LHAYDQHLN.IL.D.EE.VT.IE.DEET.EEIYK.TK.NIP..FV..DGV | |
| Retrocopy | LAISE*IYVKMRNDRELQGSLHAYDQHLNTILADLEESVTSIETDEET*EEIYKLTKQNIPLVFVQVDGV |
| Parental | VLVAPPLRVG |
| .LVAPPLRVG | |
| Retrocopy | WLVAPPLRVG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 3 .45 RPM |
| SRP014902_testis | 0 .00 RPM | 14 .85 RPM |
| SRP018288_heart | 0 .00 RPM | 26 .40 RPM |
| SRP018288_kidney | 0 .00 RPM | 45 .41 RPM |
| SRP018288_liver | 0 .00 RPM | 15 .67 RPM |
| SRP018288_lung | 0 .00 RPM | 13 .44 RPM |
| SRP018856_adipose | 0 .00 RPM | 34 .58 RPM |
| SRP035408_brain | 0 .00 RPM | 37 .92 RPM |
| SRP035408_liver | 0 .00 RPM | 45 .80 RPM |