RetrogeneDB ID: | retro_mmur_1128 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | scaffold_24111:3315..3702(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TIMM17B | ||
Ensembl ID: | ENSMICG00000005971 | ||
Aliases: | None | ||
Description: | translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:HGNC Symbol;Acc:17310] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 73.84 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GIRHRLRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAM |
G..HRLRGS......RAPQ.GGSFAV.GGLFS.IDC..V..RGKEDPW.SITSGALTGA.LAAR..P.AM | |
Retrocopy | GVNHRLRGSLTPIKTRAPQLGGSFAVGGGLFSMIDCSMVQVRGKEDPWTSITSGALTGAILAARNEPVAM |
Parental | MGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKE--GSPASGYPSYQ |
.GSA.MGGILLALIEG.GILLTR....QF.N.P.F.ED.SQLP......SP...Y..YQ | |
Retrocopy | AGSAEMGGILLALIEGAGILLTRFASAQFPNGPQFAEDLSQLPSTQLRSSPFEDYRQYQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000005971 | 3 retrocopies |
retro_mmur_1128 , retro_mmur_1272, retro_mmur_232,
|
Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
Mus musculus | ENSMUSG00000031158 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |