RetrogeneDB ID: | retro_mmus_1509 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 16:32326183..32326489(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Timm17b | ||
| Ensembl ID: | ENSMUSG00000031158 | ||
| Aliases: | None | ||
| Description: | translocase of inner mitochondrial membrane 17b [Source:MGI Symbol;Acc:MGI:1343176] |
| Percent Identity: | 91.26 % |
| Parental protein coverage: | 59.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQ |
| GGLFSTIDCGLV.LRGKEDPWNS...GALTGAVLAARSG.LAMVGSAMMG.ILLALIEGVGI.LT.YTAQ | |
| Retrocopy | GGLFSTIDCGLVQLRGKEDPWNSVTIGALTGAVLAARSGLLAMVGSAMMGRILLALIEGVGI-LTCYTAQ |
| Parental | QFRNAPPFLEDPSQLTPKEGSPAPGYPNYQQYH |
| QFRNAPPFLEDPSQLTPKEGS.APGYPNYQQYH | |
| Retrocopy | QFRNAPPFLEDPSQLTPKEGSLAPGYPNYQQYH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 9 .32 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 8 .86 RPM |
| SRP007412_heart | 0 .03 RPM | 17 .59 RPM |
| SRP007412_kidney | 0 .02 RPM | 15 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 26 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005971 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031158 | 1 retrocopy |
retro_mmus_1509 ,
|
| Mus musculus | ENSMUSG00000062580 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |