RetrogeneDB ID: | retro_pabe_1051 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:48491859..48492277(-) | ||
| Located in intron of: | ENSPPYG00000005357 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCNP | ||
| Ensembl ID: | ENSPPYG00000013591 | ||
| Aliases: | None | ||
| Description: | PEST proteolytic signal-containing nuclear protein [Source:UniProtKB/Swiss-Prot;Acc:Q5RCI9] |
| Percent Identity: | 84.62 % |
| Parental protein coverage: | 70.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | SNGGESSSRSAEKRSAEEEAVDL-PTKPTKISKFGFAIGSQTTKKA-SAISIKLGSSKP-KETVPTLAPK |
| SNG.ESSS.SAEKRSAEEEA.DL.PTKP.KIS.FGFAIGSQTTKKA.S.ISIKLGSSKP.K.....L..K | |
| Retrocopy | SNGEESSSHSAEKRSAEEEAADL<PTKPAKISNFGFAIGSQTTKKA>SPISIKLGSSKP>KKLFQLLLQK |
| Parental | TLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHD |
| .LSVAAAFNEDEDSEPEE.PPEAK.RMKNI.RDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHL.NV.D | |
| Retrocopy | -LSVAAAFNEDEDSEPEERPPEAKIRMKNIARDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLRNVYD |
| Parental | QDN |
| QDN | |
| Retrocopy | QDN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 53 .69 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 67 .61 RPM |
| SRP007412_heart | 0 .03 RPM | 34 .05 RPM |
| SRP007412_kidney | 0 .00 RPM | 40 .44 RPM |
| SRP007412_liver | 0 .03 RPM | 25 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1264 |
| Pan troglodytes | retro_ptro_864 |
| Gorilla gorilla | retro_ggor_994 |
| Macaca mulatta | retro_mmul_1312 |
| Callithrix jacchus | retro_cjac_401 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
| Homo sapiens | ENSG00000081154 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000008072 | 10 retrocopies | |
| Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000071533 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003224 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013591 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000015172 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000028411 | 1 retrocopy |