RetrogeneDB ID: | retro_ptro_790 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:112115252..112115556(-) | ||
Located in intron of: | ENSPTRG00000029540 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCNP | ||
Ensembl ID: | ENSPTRG00000015172 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.79 % |
Parental protein coverage: | 57.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEE-MPPEAKMRMKNIGRDTPTSAGP |
S..TKKAS.ISIKLGS.KPKETVPTLAP.T.S..AA..........E...PEAKM.MKNIGRDTPTSAGP | |
Retrocopy | SWMTKKASTISIKLGSNKPKETVPTLAPNTFS-GAAAFNEDEDSEPE>KSPEAKMKMKNIGRDTPTSAGP |
Parental | NSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN |
NSFNK.KHGF.DNQKLWERNIKS..GNV.DQDN | |
Retrocopy | NSFNKRKHGFFDNQKLWERNIKSYVGNVNDQDN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 59 .58 RPM |
SRP007412_cerebellum | 0 .18 RPM | 101 .02 RPM |
SRP007412_heart | 0 .09 RPM | 48 .38 RPM |
SRP007412_kidney | 0 .18 RPM | 53 .95 RPM |
SRP007412_liver | 0 .07 RPM | 30 .15 RPM |
SRP007412_testis | 0 .32 RPM | 36 .46 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1155 |
Gorilla gorilla | retro_ggor_902 |
Pongo abelii | retro_pabe_961 |
Callithrix jacchus | retro_cjac_3332 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000007972 | 11 retrocopies | |
Callithrix jacchus | ENSCJAG00000000508 | 6 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008873 | 5 retrocopies | |
Homo sapiens | ENSG00000081154 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000025423 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000005518 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000008072 | 10 retrocopies | |
Macaca mulatta | ENSMMUG00000017782 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000011696 | 1 retrocopy | |
Mus musculus | ENSMUSG00000071533 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003224 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011110 | 7 retrocopies | |
Procavia capensis | ENSPCAG00000007007 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000013591 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000015172 | 3 retrocopies |
retro_ptro_676, retro_ptro_790 , retro_ptro_864,
|
Rattus norvegicus | ENSRNOG00000028411 | 1 retrocopy |