RetrogeneDB ID: | retro_pabe_2694 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 5:144117964..144118194(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS12 | ||
Ensembl ID: | ENSPPYG00000017020 | ||
Aliases: | None | ||
Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
Percent Identity: | 57.69 % |
Parental protein coverage: | 56.82 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | DEPMYVKLVEALCAEHQINLIKVD--DNKKLGEWVGLCKIDREGKPRKVVGC-SCVVVKDYGKESQAKDV |
DEP..VK..EALCAE.Q.N..K......K..G...G.CKIDREG.P...V.C..CV.VK..GKESQ..DV | |
Retrocopy | DEPTSVKSGEALCAELQVNRLKGG**QKKPRGQVGGPCKIDREGRPCTAVSC<CCVIVKNCGKESQVEDV |
Parental | IEEYFKCK |
IEEYFKC. | |
Retrocopy | IEEYFKCR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 49 .37 RPM |
SRP007412_cerebellum | 0 .00 RPM | 77 .82 RPM |
SRP007412_heart | 0 .00 RPM | 95 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 162 .85 RPM |
SRP007412_liver | 0 .00 RPM | 172 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3249 |
Pan troglodytes | retro_ptro_2197 |
Callithrix jacchus | retro_cjac_1778 |