RetrogeneDB ID: | retro_pabe_704 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 11:68056384..68056590(+) | ||
Located in intron of: | ENSPPYG00000003653 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS12 | ||
Ensembl ID: | ENSPPYG00000017020 | ||
Aliases: | None | ||
Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
Percent Identity: | 53.52 % |
Parental protein coverage: | 53.03 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | KLVEALCAEHQINLIKVDDNKK-LGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCK |
.L.EALC.EH...L...DDNKK...E.VGL.....E...........VV.KDYGKESQ.KDVI.E.FKCK | |
Retrocopy | QLGEALCVEH*VYLFRADDNKK<TQERVGLSD*QSENACQAGLQLCVVV-KDYGKESQGKDVIKENFKCK |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 49 .37 RPM |
SRP007412_cerebellum | 0 .00 RPM | 77 .82 RPM |
SRP007412_heart | 0 .00 RPM | 95 .16 RPM |
SRP007412_kidney | 0 .03 RPM | 162 .85 RPM |
SRP007412_liver | 0 .03 RPM | 172 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Equus caballus | retro_ecab_959 |