RetrogeneDB ID: | retro_ptro_1427 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 20:31056117..31056355(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN3 | ||
Ensembl ID: | ENSPTRG00000018366 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.79 % |
Parental protein coverage: | 80.81 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KQEPTRRSARLSAKPAPPKP-EPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEA |
K.EPTR.S.RLSAKP.PPKP..P...K....K..........K..KE.K.EAGKEGTAP.EN.ETKAE.A | |
Retrocopy | KHEPTRWSPRLSAKPPPPKP>DPN*EKHLLRKNLEQTLAEVLKRRKE-KYEAGKEGTAPAENDETKAEDA |
Parental | QKTESVDNEGE |
Q.TES.D..G. | |
Retrocopy | QNTESGDISGD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .33 RPM |
SRP007412_cerebellum | 0 .00 RPM | 29 .43 RPM |
SRP007412_heart | 0 .00 RPM | 96 .44 RPM |
SRP007412_kidney | 0 .00 RPM | 63 .91 RPM |
SRP007412_liver | 0 .00 RPM | 29 .46 RPM |
SRP007412_testis | 0 .00 RPM | 20 .87 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012407 | 2 retrocopies | |
Felis catus | ENSFCAG00000028793 | 1 retrocopy | |
Homo sapiens | ENSG00000118418 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006910 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004351 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012377 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000009611 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018366 | 2 retrocopies |
retro_ptro_1427 , retro_ptro_200,
|
Ictidomys tridecemlineatus | ENSSTOG00000014353 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015468 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000005238 | 3 retrocopies |