RetrogeneDB ID: | retro_ptro_2050 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 4:51666165..51666396(-) | ||
Located in intron of: | ENSPTRG00000016200 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSPTRG00000000269 | ||
Aliases: | None | ||
Description: | mitochondrial inner membrane organizing system 1 [Source:HGNC Symbol;Acc:32068] |
Percent Identity: | 70.89 % |
Parental protein coverage: | 98.72 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | SESELGRKWDRCLADAVVKIGTGFGLGIVFS-LTFFKRRMWPLAFG-SGMGLGMAYSNCQHDFQAPYLLH |
SE.EL.RK...CLADAVVKIGTG..LGIVFS.L.FFKRR..PLAF...GM.LGMAYS..QH.FQAP.LL. | |
Retrocopy | SEPELSRK*EWCLADAVVKIGTGLELGIVFS>LSFFKRRK*PLAFS<FGMELGMAYSSHQHSFQAPCLLY |
Parental | GKYVKEQEQ |
G..V.EQEQ | |
Retrocopy | GTCVEEQEQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 54 .34 RPM |
SRP007412_cerebellum | 0 .00 RPM | 41 .30 RPM |
SRP007412_heart | 0 .03 RPM | 93 .91 RPM |
SRP007412_kidney | 0 .00 RPM | 70 .64 RPM |
SRP007412_liver | 0 .00 RPM | 52 .51 RPM |
SRP007412_testis | 0 .00 RPM | 51 .53 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2948 |
Gorilla gorilla | retro_ggor_2042 |
Pongo abelii | retro_pabe_2445 |
Macaca mulatta | retro_mmul_1949 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
Homo sapiens | ENSG00000173436 | 3 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies |
retro_ptro_1868, retro_ptro_2050 ,
|
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |