RetrogeneDB ID: | retro_mmul_1268 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:60287721..60287940(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MINOS1 | ||
| Ensembl ID: | ENSMMUG00000005855 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.41 % |
| Parental protein coverage: | 93.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKE |
| .GRKWD.CLADAVVKIGT.FGLGIVFSLTFFKRRMWPLAF.SG.GLGMAYSNCQHDFQAPYLLHGKYV.. | |
| Retrocopy | VGRKWDWCLADAVVKIGTDFGLGIVFSLTFFKRRMWPLAFSSGTGLGMAYSNCQHDFQAPYLLHGKYVNK |
| Parental | QEQ |
| QEQ | |
| Retrocopy | QEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 37 .54 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 42 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 82 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 48 .71 RPM |
| SRP007412_liver | 0 .08 RPM | 17 .26 RPM |
| SRP007412_testis | 0 .04 RPM | 28 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
| Homo sapiens | ENSG00000173436 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies |
retro_mmul_1268 , retro_mmul_1949,
|
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |