RetrogeneDB ID: | retro_etel_978 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_194825:7341..7530(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MINOS1 | ||
| Ensembl ID: | ENSETEG00000010942 | ||
| Aliases: | None | ||
| Description: | mitochondrial inner membrane organizing system 1 [Source:HGNC Symbol;Acc:32068] |
| Percent Identity: | 56.06 % |
| Parental protein coverage: | 84.62 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DRCLADAVVKIGTGFGLGIIFSLTVFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKFVKLQ |
| D..L...VVK.G...G...IF....FK...W.LAF.SGMGL.MAYS.CQ.D.QA.YLLHGK..K.Q | |
| Retrocopy | DLSLVSVVVKTG---GFRMIFASAFFKCNTWMLAFSSGMGLPMAYSKCQRDLQAEYLLHGKYTKEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
| Homo sapiens | ENSG00000173436 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |