RetrogeneDB ID: | retro_ptro_2243 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:32590123..32590424(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPDPF | ||
Ensembl ID: | ENSPTRG00000013739 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.31 % |
Parental protein coverage: | 87.72 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | AAIPSSGSLVATHDYYR-RRLGSTSSNSSCSSTECPGEAIP-HPPGLPKADPGHWWASFF-FGKSTLPFM |
AAI.SSGS.....DYY....LGSTS.N..C.S....G...P.H...LPKA.P.HW.ASFF.F.K..LPFM | |
Retrocopy | AAISSSGSFPLMRDYYK<MLLGSTSTNGFCGSVYYLGMPSPYHHQSLPKAGPNHW*ASFF<FEKCILPFM |
Parental | ATVLESAEHSEPPQASSSMTTCGLARDAPRKQP |
ATVLES.EHS..PQ.SS.M.T..L...A.RK.P | |
Retrocopy | ATVLESSEHSGSPQVSSCMSTHDLSGEALRKRP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 45 .60 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .85 RPM |
SRP007412_heart | 0 .00 RPM | 32 .99 RPM |
SRP007412_kidney | 0 .00 RPM | 125 .29 RPM |
SRP007412_liver | 0 .00 RPM | 50 .71 RPM |
SRP007412_testis | 0 .00 RPM | 4 .64 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3205 |
Macaca mulatta | retro_mmul_2020 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
Homo sapiens | ENSG00000125534 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy |
retro_ptro_2243 ,
|
Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |