RetrogeneDB ID: | retro_ecab_477 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 19:48397426..48397768(-) | ||
| Located in intron of: | ENSECAG00000023294 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPDPF | ||
| Ensembl ID: | ENSECAG00000009413 | ||
| Aliases: | None | ||
| Description: | pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) [Source:HGNC Symbol;Acc:16142] |
| Percent Identity: | 96.49 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAAIPSS-SLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWWTSFFFGKSTLPFMAT |
| MAAIPSS.SLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWW.SFF.GKSTLPFM.T | |
| Retrocopy | MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWWASFFSGKSTLPFMTT |
| Parental | VLESPEHSESPQASSSTITCDLAPEASRKQPGGQPAKANAGPRS |
| VLESPEHSESPQASSSTITCDLAPEASRKQPGGQPAKANAGPRS | |
| Retrocopy | VLESPEHSESPQASSSTITCDLAPEASRKQPGGQPAKANAGPRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 7 .02 RPM | 19 .13 RPM |
| SRP021940_cerebellum | 5 .40 RPM | 15 .89 RPM |
| SRP021940_embryo | 13 .20 RPM | 31 .66 RPM |
| SRP021940_placental_villous | 6 .83 RPM | 20 .98 RPM |
| SRP021940_synovial_membrane | 6 .92 RPM | 14 .63 RPM |
| SRP021940_testis | 25 .45 RPM | 72 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
| Equus caballus | ENSECAG00000009413 | 1 retrocopy |
retro_ecab_477 ,
|
| Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
| Homo sapiens | ENSG00000125534 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
| Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |