RetrogeneDB ID: | retro_btau_1339 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 4:15578156..15578484(-) | ||
| Located in intron of: | ENSBTAG00000013781 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.53925 | ||
| Ensembl ID: | ENSBTAG00000031800 | ||
| Aliases: | PPDPF, C13H20orf149, C20orf149 | ||
| Description: | Pancreatic progenitor cell differentiation and proliferation factor [Source:UniProtKB/Swiss-Prot;Acc:Q3ZCB6] |
| Percent Identity: | 95.45 % |
| Parental protein coverage: | 94.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWWASFFFGKSTLPFMAT |
| MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSAEYPGE.IPHHPGLPKADPGHWWASFFFGKSTLPFM.T | |
| Retrocopy | MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSAEYPGEVIPHHPGLPKADPGHWWASFFFGKSTLPFMVT |
| Parental | VLESPEHS-ESAQASTSTITCDLAQKAVGKQQPSGQPGKT |
| VLESPEHS.ESAQASTSTITCDLA..AVGKQQPSGQPGKT | |
| Retrocopy | VLESPEHS>ESAQASTSTITCDLAREAVGKQQPSGQPGKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .14 RPM | 19 .61 RPM |
| ERP005899_muscle | 0 .05 RPM | 114 .87 RPM |
| SRP017611_brain | 0 .46 RPM | 37 .96 RPM |
| SRP017611_kidney | 0 .36 RPM | 84 .52 RPM |
| SRP017611_liver | 0 .08 RPM | 32 .24 RPM |
| SRP030211_testis | 0 .88 RPM | 54 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031800 | 7 retrocopies |
retro_btau_1339 , retro_btau_1538, retro_btau_1606, retro_btau_1817, retro_btau_1857, retro_btau_385, retro_btau_54,
|
| Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
| Homo sapiens | ENSG00000125534 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
| Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |