RetrogeneDB ID: | retro_lcha_69 | ||
Retrocopylocation | Organism: | Coelacanth (Latimeria chalumnae) | |
Coordinates: | JH127193.1:190666..190939(-) | ||
Located in intron of: | ENSLACG00000003609 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPDPF | ||
Ensembl ID: | ENSLACG00000002835 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.85 % |
Parental protein coverage: | 78.95 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | SGSLIATHDYYRRRLGSTSS-NSSCGSIEYSGEVIPHPPGLPKSDPGHWWASFFFGKPNHPTMTTVSEFP |
S..LIA.H..YRR.LG......SSC.SIEYS.EV.PHP.GL.KS.PG.W.AS.FF.K.NH....TV.... | |
Retrocopy | SSPLIAAHNSYRRHLGVHLQ*HSSCRSIEYSREVTPHPVGLLKSNPGYW*ASVFFKKQNHLAVITVPVSS |
Parental | ESSKSVSVVNGKINCGLAQEV |
E...S.S..N....CGL.QEV | |
Retrocopy | EIPRSISLINNRMVCGLTQEV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
DRP000627_gill | 0 .00 RPM | 368 .80 RPM |
DRP000627_kidney | 0 .00 RPM | 343 .48 RPM |
DRP000627_pectoral_fin | 0 .00 RPM | 375 .82 RPM |
DRP000627_pelvic_fin | 0 .00 RPM | 587 .35 RPM |
DRP000627_pharynx | 0 .00 RPM | 293 .20 RPM |
DRP000627_tail_muscle | 0 .00 RPM | 293 .35 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
Homo sapiens | ENSG00000125534 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy |
retro_lcha_69 ,
|
Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |