RetrogeneDB ID: | retro_mmul_41 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:85608245..85608443(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000019592 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPDPF | ||
| Ensembl ID: | ENSMMUG00000006064 | ||
| Aliases: | None | ||
| Description: | pancreatic progenitor cell differentiation and proliferation factor [Source:RefSeq peptide;Acc:NP_001253878] |
| Percent Identity: | 89.39 % |
| Parental protein coverage: | 57.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLP |
| MAAIPSSGSL.AT.DYYR.RL.ST.SNSSCGS.ECPGEAIPHPPGLPKADPGHWWAS.FFGKSTLP | |
| Retrocopy | MAAIPSSGSLLATYDYYRCRLDSTFSNSSCGSIECPGEAIPHPPGLPKADPGHWWASLFFGKSTLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 2 .91 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 25 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .81 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .90 RPM |
| SRP007412_liver | 0 .04 RPM | 97 .93 RPM |
| SRP007412_testis | 0 .08 RPM | 19 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031800 | 7 retrocopies | |
| Equus caballus | ENSECAG00000009413 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024386 | 14 retrocopies | |
| Homo sapiens | ENSG00000125534 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000002835 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026496 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006064 | 2 retrocopies |
retro_mmul_2020, retro_mmul_41 ,
|
| Monodelphis domestica | ENSMODG00000016871 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008301 | 12 retrocopies | |
| Mus musculus | ENSMUSG00000016344 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010068 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008810 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000013739 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012722 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018338 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000007808 | 1 retrocopy |