RetrogeneDB ID: | retro_rnor_1462 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 19:47565902..47566136(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Dynlt3 | ||
Ensembl ID: | ENSRNOG00000003611 | ||
Aliases: | Dynlt3, Tcte1l | ||
Description: | dynein light chain Tctex-type 3 [Source:RefSeq peptide;Acc:NP_001013246] |
Percent Identity: | 57.69 % |
Parental protein coverage: | 67.24 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | GYQRPCDEIGFNAEEAHNIVKECVEGVLGGNDYNQNSINQWTASIVEQSIAHLVKLGKAYKYIVTCAVVQ |
G...P.D...F.A.E.HN.V..CV..VLGG..YNQN.INQW....VEQ...HLVKLG.AYKYIV.CAVV. | |
Retrocopy | GQSQPYDKVIFSADETHNKV*KCVDEVLGGESYNQNNINQWITNRVEQFLKHLVKLGNAYKYIVICAVV* |
Parental | RSPYGFHV |
...Y.FH. | |
Retrocopy | QNAYKFHL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 87 .64 RPM |
SRP017611_kidney | 0 .00 RPM | 44 .59 RPM |
SRP017611_liver | 0 .00 RPM | 16 .47 RPM |