RetrogeneDB ID: | retro_rnor_1462 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 19:47565902..47566136(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Dynlt3 | ||
| Ensembl ID: | ENSRNOG00000003611 | ||
| Aliases: | Dynlt3, Tcte1l | ||
| Description: | dynein light chain Tctex-type 3 [Source:RefSeq peptide;Acc:NP_001013246] |
| Percent Identity: | 57.69 % |
| Parental protein coverage: | 67.24 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | GYQRPCDEIGFNAEEAHNIVKECVEGVLGGNDYNQNSINQWTASIVEQSIAHLVKLGKAYKYIVTCAVVQ |
| G...P.D...F.A.E.HN.V..CV..VLGG..YNQN.INQW....VEQ...HLVKLG.AYKYIV.CAVV. | |
| Retrocopy | GQSQPYDKVIFSADETHNKV*KCVDEVLGGESYNQNNINQWITNRVEQFLKHLVKLGNAYKYIVICAVV* |
| Parental | RSPYGFHV |
| ...Y.FH. | |
| Retrocopy | QNAYKFHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 87 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 44 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .47 RPM |