RetrogeneDB ID: | retro_rnor_652 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 1:249660804..249661020(-) | ||
| Located in intron of: | ENSRNOG00000015232 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Dynlt3 | ||
| Ensembl ID: | ENSRNOG00000003611 | ||
| Aliases: | Dynlt3, Tcte1l | ||
| Description: | dynein light chain Tctex-type 3 [Source:RefSeq peptide;Acc:NP_001013246] |
| Percent Identity: | 64.94 % |
| Parental protein coverage: | 61.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | SIVEQSIAHLVKLGKAYKYIVTCAVVQRSPY-GF-HVAS---SCFWDTTSDGT-CTVRWENRTMNCVVNV |
| SIVEQS.A.L.KLGK..KYIVTCAVVQ.....GF.HVAS....CF.DTTSDGT.C.V.W.NR.MN....V | |
| Retrocopy | SIVEQSPAPLEKLGKVHKYIVTCAVVQECIW<GF<HVASLACPCFGDTTSDGT<CGVKWDNRIMNFIFKV |
| Parental | FAVAIVL |
| .AV.IVL | |
| Retrocopy | -AVTIVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 87 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 44 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .47 RPM |