RetrogeneDB ID: | retro_tbel_3460 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_141385:113286..113519(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DYNLT3 | ||
| Ensembl ID: | ENSTBEG00000014383 | ||
| Aliases: | None | ||
| Description: | dynein, light chain, Tctex-type 3 [Source:HGNC Symbol;Acc:11694] |
| Percent Identity: | 53.16 % |
| Parental protein coverage: | 75.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VDGVLGGEDYNQNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCT |
| .....GG..Y.....NQWT...VEQ.L..L.KLGK...YIV.C...QK...G.HTASSCFWD...DG.CT | |
| Retrocopy | IESAIGGNAYQHSEVNQWTTNVVEQTLSQLTKLGKPFEYIVICVIMQKNGAGLHTASSCFWDSSADGSCT |
| Parental | -VRWENRTM |
| ..RWEN.TM | |
| Retrocopy | <PRWENKTM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |