RetrogeneDB ID: | retro_rnor_1893 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:79185774..79186005(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl30 | ||
| Ensembl ID: | ENSRNOG00000005975 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L30 [Source:UniProtKB/Swiss-Prot;Acc:P62890] |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 66.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSM |
| .Q.K..LVILANNCP..RKSEIEYYAMLAKTGVHHYSG.NIELGTA.GKYY..CTLA..DPGDS..IR.M | |
| Retrocopy | KQSKKLLVILANNCPLSRKSEIEYYAMLAKTGVHHYSGINIELGTAGGKYYQACTLATTDPGDSRPIRGM |
| Parental | PEQTGEK |
| PE.T.EK | |
| Retrocopy | PERTAEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 51 .05 RPM |
| SRP017611_kidney | 0 .00 RPM | 58 .20 RPM |
| SRP017611_liver | 0 .00 RPM | 49 .35 RPM |