RetrogeneDB ID: | retro_rnor_2452 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 7:38519420..38519765(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cwc15 | ||
| Ensembl ID: | ENSRNOG00000008490 | ||
| Aliases: | Cwc15, RGD1310669 | ||
| Description: | Spliceosome-associated protein CWC15 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5BJP2] |
| Percent Identity: | 66.39 % |
| Parental protein coverage: | 50.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | PTREHTTSSSVS-KKPRL--DQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKI-KKERAEEQ |
| P..EHTTSSSV..KKP.L..D..PA.NLDA..PLTDEEDE.FEEESDDDDT.A.L.EL.....KERA..Q | |
| Retrocopy | PSQEHTTSSSVL<KKPHLGLDKTPATNLDAVPPLTDEEDEGFEEESDDDDTVA-LVELXXX>NKERAKAQ |
| Parental | ARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVV |
| ARKE.EQKAE..RI..ENIL.G.PL.NLT...Q.Q..FKVKR..DDDV. | |
| Retrocopy | ARKEKEQKAEW-RIPKENILRGSPLFNLTDTPQSQGHFKVKRS*DDDVM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .39 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .47 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_593 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011392 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000007913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004134 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004188 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006249 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011075 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006649 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007826 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002032 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000004096 | 2 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000010404 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001629 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001686 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008490 | 3 retrocopies |
retro_rnor_2452 , retro_rnor_251, retro_rnor_476,
|
| Sarcophilus harrisii | ENSSHAG00000016534 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000407 | 1 retrocopy |