RetrogeneDB ID: | retro_shar_752 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL861848.1:35244..35674(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HNRNPD | ||
| Ensembl ID: | ENSSHAG00000013312 | ||
| Aliases: | None | ||
| Description: | heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) [Source:HGNC Symbol;Acc:5036] |
| Percent Identity: | 57.62 % |
| Parental protein coverage: | 52.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MFIGGLSWDTTKKDLKDYFSKFGEVVDC--TLKLDPITGRSRGFGFVLFKESESVDKVMDQKE-HKLNGK |
| ..IG.LSW.TTKKDLK.Y.SKFGE..DC..T.KL..IT..SRGFGFVLFK.S.S.DKVMDQK..HKL..K | |
| Retrocopy | LYIGSLSWETTKKDLKNYVSKFGEQEDCPITVKLQTITW*SRGFGFVLFKKSDSIDKVMDQKK>HKLICK |
| Parental | VIDPKRAKAMKTKEPVKK-IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEE |
| .I.....K....KE.V.....VG.LS.....EKIREY...FGEVES.E.....K.N.R.G.CF..FKEEE | |
| Retrocopy | MI--QESKSRGKKEHVNL>VVVGCLSSGIL-EKIREYYNDFGEVESVEFLL--KYNPRCGLCFTNFKEEE |
| Parental | PVKK-IMEKKY |
| ..KK..MEK.Y | |
| Retrocopy | IIKK<MMEKTY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015165 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000012507 | 1 retrocopy | |
| Homo sapiens | ENSG00000138668 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026760 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000016483 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016215 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000013312 | 1 retrocopy |
retro_shar_752 ,
|
| Sarcophilus harrisii | ENSSHAG00000013616 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000018255 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002327 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010395 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007592 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004374 | 2 retrocopies |