RetrogeneDB ID: | retro_acar_97 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
Coordinates: | 3:85004795..85005126(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SSR4 | ||
Ensembl ID: | ENSACAG00000011328 | ||
Aliases: | None | ||
Description: | signal sequence receptor, delta [Source:HGNC Symbol;Acc:11326] |
Percent Identity: | 72.57 % |
Parental protein coverage: | 64.91 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | NVALYADVNGKQFPVTRGQ-DVGRYQVSWSMEHKLARSGTYEVKFFDEESYSILRKAQRNNEDVSDIKPL |
..ALYAD.NGKQF.VTRG..DVG.Y.VSWS.EHKLA....Y.VK.FDEESYSIL.KAQ.NNED.SDIK.L | |
Retrocopy | DAALYADINGKQFLVTRGW<DVGCYWVSWSIEHKLAHWVAYVVKLFDEESYSILQKAQCNNEDTSDIKSL |
Parental | FTVNVDHRGAWNGPWVSTEVLAA-LIGLLVYYMAFSAKSNIQA |
FTV..DH.GAW.GP.VST.VLAA..IGLLV.YMAFS..SNI.A | |
Retrocopy | FTVSMDHLGAWRGPCVSTKVLAA<FIGLLVCYMAFSVESNISA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP009831_adrenal | 0 .00 RPM | 639 .80 RPM |
SRP009831_brain | 0 .00 RPM | 73 .24 RPM |
SRP009831_dewlap | 0 .00 RPM | 136 .81 RPM |
SRP009831_embryo | 0 .00 RPM | 279 .40 RPM |
SRP009831_heart | 0 .00 RPM | 96 .97 RPM |
SRP009831_liver | 0 .00 RPM | 513 .65 RPM |
SRP009831_lung | 0 .00 RPM | 207 .89 RPM |
SRP009831_ovary | 0 .00 RPM | 127 .21 RPM |
SRP009831_skeletal_muscle | 0 .00 RPM | 120 .26 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000011328 | 1 retrocopy |
retro_acar_97 ,
|
Callithrix jacchus | ENSCJAG00000011167 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000025714 | 2 retrocopies | |
Homo sapiens | ENSG00000180879 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000024329 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000006908 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008803 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013602 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006738 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000009037 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012784 | 1 retrocopy |