RetrogeneDB ID: | retro_dnov_922 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_122205:7869..8215(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSR4 | ||
| Ensembl ID: | ENSDNOG00000025714 | ||
| Aliases: | None | ||
| Description: | signal sequence receptor, delta [Source:HGNC Symbol;Acc:11326] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 67.63 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | AAVASLG-ALALLLLSSLSCCSAEACMEPQITPS-YYTTSDAVISTETVFIVEISLTCKNRVQNMVLYAD |
| AAVA.LG.ALA.LL.SSLSCCSAEAC.EPQ.TPS.Y.TTS.A.IST.T.F..EISLTCKN.VQNM.L.AD | |
| Retrocopy | AAVALLG<ALAFLL-SSLSCCSAEACVEPQTTPS<YCTTSGAIISTNTFFVMEISLTCKNSVQNMALQAD |
| Parental | VGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKA |
| ..GKQFP.T..QD.G..QVSWSLDHKS...GTYEV.F.D.ES.SL..KA | |
| Retrocopy | ISGKQFPFTGVQDAGC*QVSWSLDHKSTRPGTYEVQFLDKESFSLR*KA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 318 .73 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 87 .43 RPM |
| SRP012922_heart | 0 .00 RPM | 89 .10 RPM |
| SRP012922_kidney | 0 .00 RPM | 223 .96 RPM |
| SRP012922_liver | 0 .00 RPM | 208 .52 RPM |
| SRP012922_lung | 0 .00 RPM | 213 .81 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 84 .64 RPM |
| SRP012922_spleen | 0 .00 RPM | 293 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000011328 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011167 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000025714 | 2 retrocopies |
retro_dnov_1204, retro_dnov_922 ,
|
| Homo sapiens | ENSG00000180879 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024329 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006908 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008803 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013602 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006738 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000009037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012784 | 1 retrocopy |