RetrogeneDB ID: | retro_btau_1003 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 23:11198524..11198805(+) | ||
| Located in intron of: | ENSBTAG00000014253 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GLO1 | ||
| Ensembl ID: | ENSBTAG00000012703 | ||
| Aliases: | None | ||
| Description: | lactoylglutathione lyase [Source:RefSeq peptide;Acc:NP_001076965] |
| Percent Identity: | 71.58 % |
| Parental protein coverage: | 51.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | AWVFSRKATLELTHNWGTEDDET-QSYHSGNSDPRGFGHIGIAVPDVHGACKRFEELGIKFVKKPDDGKM |
| .W..SRKA.LELTHNW..ED..T.QSYHSG.S.P.GFGHI.IA.PDVHGACK.FE.LG...V.KPDDGKM | |
| Retrocopy | SWAISRKAALELTHNWSAEDTGT<QSYHSGDSGPQGFGHIEIAIPDVHGACKMFEKLGVQCVEKPDDGKM |
| Parental | KGLAFIQDPDGYWIEILNPNTMITI |
| KGLAFI..PDG.W.EILNPN.M.T. | |
| Retrocopy | KGLAFIHNPDGFWNEILNPNKMMTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 352 .40 RPM |
| ERP005899_muscle | 0 .05 RPM | 71 .53 RPM |
| SRP017611_brain | 0 .00 RPM | 70 .71 RPM |
| SRP017611_kidney | 0 .00 RPM | 104 .67 RPM |
| SRP017611_liver | 0 .00 RPM | 125 .42 RPM |
| SRP030211_testis | 0 .02 RPM | 11 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012703 | 2 retrocopies |
retro_btau_1003 , retro_btau_1513,
|
| Cavia porcellus | ENSCPOG00000010050 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019598 | 6 retrocopies | |
| Dipodomys ordii | ENSDORG00000006369 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005978 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024026 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007945 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000541 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000027778 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005821 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014386 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004664 | 1 retrocopy |