RetrogeneDB ID: | retro_btau_1735 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | X:35340346..35340658(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDCD2 | ||
Ensembl ID: | ENSBTAG00000014772 | ||
Aliases: | None | ||
Description: | nudC domain-containing protein 2 [Source:RefSeq peptide;Acc:NP_001035643] |
Percent Identity: | 78.85 % |
Parental protein coverage: | 66.24 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESDYAADPWVQDQMQRKLT |
.A.G......GKLFDSTIADEGTWTLEDRKM..IV.TK..RDA.NCWT.L.E..Y.A.PWVQDQMQRKLT | |
Retrocopy | VATGSSR*WQGKLFDSTIADEGTWTLEDRKMIHIVFTKMRRDAKNCWTYLPEYEYTAHPWVQDQMQRKLT |
Parental | LERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK |
L.RFQKENPGFDFSGAEISGNYTKGGPDFSN.EK | |
Retrocopy | LGRFQKENPGFDFSGAEISGNYTKGGPDFSNHEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 32 .66 RPM |
ERP005899_muscle | 0 .00 RPM | 17 .05 RPM |
SRP017611_brain | 0 .00 RPM | 8 .86 RPM |
SRP017611_kidney | 0 .00 RPM | 17 .78 RPM |
SRP017611_liver | 0 .00 RPM | 14 .88 RPM |
SRP030211_testis | 0 .00 RPM | 18 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005270 | 1 retrocopy | |
Bos taurus | ENSBTAG00000014772 | 1 retrocopy |
retro_btau_1735 ,
|
Callithrix jacchus | ENSCJAG00000015367 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000877 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000014291 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004802 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001670 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007641 | 2 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000021414 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005783 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024929 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007551 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028665 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000307 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000008090 | 1 retrocopy |