RetrogeneDB ID: | retro_cpor_936 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_35:11020650..11020955(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDCD2 | ||
Ensembl ID: | ENSCPOG00000000877 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.33 % |
Parental protein coverage: | 65.61 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LAVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLT |
...GG.E.LK.K..DST.AD..T..LE.RK....VL.KTKRD........LESE..ADPW.QDQ....L. | |
Retrocopy | VGLGGCETLKTKT-DSTVADSRTGILEVRKIGCVVLLKTKRDTVQPDAVSLESECEADPWSQDQARCRLR |
Parental | -LERFQKENPGFDFSGAEISGNYTKGGP-DFSNLE |
..ER.QKE...FD.SG..ISGN.T.GGP..FS.LE | |
Retrocopy | GRERLQKES-AFDSSGTGISGNHTGGGP<SFSSLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 16 .39 RPM |
SRP017611_kidney | 0 .00 RPM | 17 .17 RPM |
SRP017611_liver | 0 .00 RPM | 18 .67 RPM |
SRP040447_lung | 0 .00 RPM | 12 .89 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 11 .68 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005270 | 1 retrocopy | |
Bos taurus | ENSBTAG00000014772 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015367 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000877 | 1 retrocopy |
retro_cpor_936 ,
|
Dipodomys ordii | ENSDORG00000014291 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004802 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001670 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007641 | 2 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000021414 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005783 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024929 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007551 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028665 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000307 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000008090 | 1 retrocopy |