RetrogeneDB ID: | retro_chof_1042 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_188488:3490..3714(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM5 | ||
Ensembl ID: | ENSCHOG00000005335 | ||
Aliases: | None | ||
Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17162] |
Percent Identity: | 94.74 % |
Parental protein coverage: | 98.68 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAANATTNPSQLLPLELVDKCIGSRIHIVMK-SDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKL |
MAAN.TTNPSQLLPLELVDKCIGSRIH..MK.SDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKL | |
Retrocopy | MAANVTTNPSQLLPLELVDKCIGSRIHNLMK<SDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKL |
Parental | DQILLN |
DQILLN | |
Retrocopy | DQILLN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005335 | 1 retrocopy |
retro_chof_1042 ,
|
Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000012662 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000006449 | 9 retrocopies |