RetrogeneDB ID: | retro_itri_1199 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393398.1:5816887..5817052(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM5 | ||
Ensembl ID: | ENSSTOG00000012662 | ||
Aliases: | None | ||
Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17162] |
Percent Identity: | 52.73 % |
Parental protein coverage: | 58.24 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | TLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV--PGGEGPEV |
TLL.FD.FV.MVLE..TEFE.....RRITK.DQ..L..N...ML....G..G.E. | |
Retrocopy | TLLAFDEFVHMVLEVATEFEVILGRRRITKSDQSVLSANSVPMLMLEKGQKGAEI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005335 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008121 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000012662 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000006449 | 9 retrocopies |