RetrogeneDB ID: | retro_chof_672 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_133736:4526..4769(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AKIRIN1 | ||
| Ensembl ID: | ENSCHOG00000003010 | ||
| Aliases: | None | ||
| Description: | akirin 1 [Source:HGNC Symbol;Acc:25744] |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 68.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SEACTSESHPHPSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYE |
| S....S......SAL.AP..P.SS...K..P.FT..Q..IICERL.K...DKIRE.Y.Q.LNTKLA.Q.E | |
| Retrocopy | SDRKASSGGARSSALPAPRPPRSSRTEKSPPIFTVHQCVIICERLFKNNGDKIREAYQQKLNTKLADQHE |
| Parental | SFVKFTHDQIM |
| S.VKF..DQIM | |
| Retrocopy | SVVKFAPDQIM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |