RetrogeneDB ID: | retro_cjac_1352 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 15:72194872..72195203(+) | ||
Located in intron of: | ENSCJAG00000006554 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SERF2 | ||
Ensembl ID: | ENSCJAG00000002541 | ||
Aliases: | C10H15orf63, HYPK | ||
Description: | None |
Percent Identity: | 81.42 % |
Parental protein coverage: | 63.79 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | LETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSREQKAKQEREKELAKV |
.ETETSGPERPPEKPRKHDSGA.DLE.VTDYAEEK.IQSSNLE.AMSVIGDR.SREQKAKQE.EKELAK. | |
Retrocopy | IETETSGPERPPEKPRKHDSGAVDLELVTDYAEEKGIQSSNLEMAMSVIGDRKSREQKAKQEHEKELAKA |
Parental | -TIKKEDLELIMTEMEISRAAAE-RSLREHMGNVVEALIALTN |
.T..KEDLELI.TEME.S.AA.E.R.L.EHMGNV.E.LIA.TN | |
Retrocopy | <TVRKEDLELIRTEMELSQAATE<RQLGEHMGNVLEVLIAPTN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .20 RPM | 21 .34 RPM |
SRP051959_heart | 0 .12 RPM | 20 .21 RPM |
SRP051959_kidney | 0 .22 RPM | 20 .72 RPM |
SRP051959_liver | 0 .11 RPM | 22 .77 RPM |
SRP051959_lung | 0 .23 RPM | 20 .53 RPM |
SRP051959_lymph_node | 0 .30 RPM | 17 .69 RPM |
SRP051959_skeletal_muscle | 0 .15 RPM | 24 .33 RPM |
SRP051959_spleen | 0 .19 RPM | 22 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002541 | 2 retrocopies |
retro_cjac_1352 , retro_cjac_748,
|
Echinops telfairi | ENSETEG00000007464 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000014809 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013059 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017744 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005454 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001161 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000010201 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006424 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000038721 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000015703 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006916 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000003726 | 1 retrocopy |