RetrogeneDB ID: | retro_ocun_967 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 18:13547071..13547290(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HYPK | ||
Ensembl ID: | ENSOCUG00000001161 | ||
Aliases: | None | ||
Description: | huntingtin interacting protein K (HYPK), mRNA [Source:RefSeq mRNA;Acc:NM_001171256] |
Percent Identity: | 58.11 % |
Parental protein coverage: | 56.06 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QSSNLETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALI |
..SNLE...S..GDR.S.........EKELA.VTIKKEDLELI.TE.E.S.AAA..SL..H.GN..EA.I | |
Retrocopy | EGSNLEMTRSITGDRLSGSRNLNRQ-EKELAEVTIKKEDLELILTEKETSQAAAKASLQKHTGNMLEAFI |
Parental | ALTN |
A.TN | |
Retrocopy | AQTN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 34 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 21 .49 RPM |
SRP017611_liver | 0 .00 RPM | 8 .17 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002541 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000007464 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000014809 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013059 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017744 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005454 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001161 | 2 retrocopies |
retro_ocun_1395, retro_ocun_967 ,
|
Otolemur garnettii | ENSOGAG00000010201 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006424 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000038721 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000015703 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006916 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000003726 | 1 retrocopy |