RetrogeneDB ID: | retro_cjac_3303 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:53485267..53485645(-) | ||
| Located in intron of: | ENSCJAG00000014762 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS25 | ||
| Ensembl ID: | ENSCJAG00000017160 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.72 % |
| Parental protein coverage: | 71.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | LQYLNQGNVV-FKDSVKVMTVNYNTRGELGEGARKFVFFNIPQIQYK-NPWVQIMMFKNMTPSPFLRFYL |
| LQY..QG.VV.F.D.VKV.TVNYN....L.EGARK..F.NIPQIQ.K.N.W.QIMMFKNM...PFL.FYL | |
| Retrocopy | LQYPDQGDVVVFRDMVKVITVNYNKYEFLSEGARKSAFSNIPQIQFK>NTWIQIMMFKNMISLPFLQFYL |
| Parental | DSGEQVLVDVETKSNKEIMEHIRKILGKTEETLR-EEEE-EKKQLSHPANFGPRKYCL |
| ...EQVLVD.E.K..KEIMEH..KI.GK.E.TL.....E.EKKQLSHPA........L | |
| Retrocopy | YYEEQVLVDTEIKVSKEIMEHTKKIIGKNEVTLK<DQKEQEKKQLSHPAHLAFKVFFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .24 RPM | 6 .79 RPM |
| SRP051959_heart | 0 .23 RPM | 13 .05 RPM |
| SRP051959_kidney | 0 .51 RPM | 7 .99 RPM |
| SRP051959_liver | 0 .19 RPM | 12 .87 RPM |
| SRP051959_lung | 0 .37 RPM | 6 .41 RPM |
| SRP051959_lymph_node | 0 .39 RPM | 8 .42 RPM |
| SRP051959_skeletal_muscle | 0 .24 RPM | 13 .32 RPM |
| SRP051959_spleen | 0 .34 RPM | 9 .31 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1127 |
| Pan troglodytes | retro_ptro_678 |
| Gorilla gorilla | retro_ggor_880 |
| Pongo abelii | retro_pabe_932 |
| Macaca mulatta | retro_mmul_874 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017160 | 1 retrocopy |
retro_cjac_3303 ,
|
| Homo sapiens | ENSG00000131368 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011005 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000009006 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005157 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005218 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013409 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000008882 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014658 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010912 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027997 | 1 retrocopy |