RetrogeneDB ID: | retro_mmul_874 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 11:61455477..61455808(-) | ||
Located in intron of: | ENSMMUG00000007659 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.16776 | ||
Ensembl ID: | ENSMMUG00000005157 | ||
Aliases: | None | ||
Description: | 28S ribosomal protein S25, mitochondrial [Source:RefSeq peptide;Acc:NP_001244599] |
Percent Identity: | 64.91 % |
Parental protein coverage: | 64.74 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | PWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLRE-EEEKKKELSHPAN |
PW.QIMMF.N..PSPFL.FYL...EQVLVD.E.K.NKEIMEHI.KI.GKNE.T..E.E.E.KK.LSHP.. | |
Retrocopy | PWMQIMMFENTIPSPFLQFYLYYEEQVLVDIEIKMNKEIMEHIKKIMGKNEDTRKE<EQE-KKQLSHPSR |
Parental | FG-PRKYCLRECICEVEGQVPCPSVVPLPKEMRGKYKAILKASA |
FG.P.K..L.E...EV.GQ...P..V.LPKE..GKYKA.LKASA | |
Retrocopy | FG<PSK*FLWESTHEVKGQASYPGLVALPKEKTGKYKATLKASA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 18 .04 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .54 RPM |
SRP007412_cerebellum | 0 .26 RPM | 14 .85 RPM |
SRP007412_heart | 0 .00 RPM | 23 .85 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .71 RPM |
SRP007412_liver | 0 .04 RPM | 29 .57 RPM |
SRP007412_testis | 0 .15 RPM | 45 .27 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1127 |
Pan troglodytes | retro_ptro_678 |
Gorilla gorilla | retro_ggor_880 |
Pongo abelii | retro_pabe_932 |
Callithrix jacchus | retro_cjac_3303 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017160 | 1 retrocopy | |
Homo sapiens | ENSG00000131368 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011005 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000009006 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005157 | 2 retrocopies |
retro_mmul_1946, retro_mmul_874 ,
|
Nomascus leucogenys | ENSNLEG00000005218 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013409 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000008882 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014658 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000010912 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027997 | 1 retrocopy |