RetrogeneDB ID: | retro_ggor_880 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:62755325..62755650(-) | ||
Located in intron of: | ENSGGOG00000006089 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS25 | ||
Ensembl ID: | ENSGGOG00000011005 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.16 % |
Parental protein coverage: | 64.74 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | PWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLRE-EEEEKKQLSHPAN |
PW.QIMMFKN..P.PFL.FYL...E.VLVD.E.K.NKEIMEHI.KI.GKNE.T..E.E.E.KKQLSH.A. | |
Retrocopy | PWMQIMMFKNTIPLPFLQFYLYYEEHVLVDIEIKMNKEIMEHIKKIVGKNEDTRKE<EQE-KKQLSHRAH |
Parental | FG-PRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADA |
FG.P.K....E..CEV.GQVP.P.L.....E..GKYKA.LKA.A | |
Retrocopy | FG<PSK*F*WESTCEVKGQVPYPGL--MH*EKTGKYKATLKASA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 28 .24 RPM |
SRP007412_cerebellum | 0 .00 RPM | 19 .86 RPM |
SRP007412_heart | 0 .03 RPM | 19 .11 RPM |
SRP007412_kidney | 0 .04 RPM | 52 .38 RPM |
SRP007412_liver | 0 .16 RPM | 28 .41 RPM |
SRP007412_testis | 0 .21 RPM | 44 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1127 |
Pan troglodytes | retro_ptro_678 |
Pongo abelii | retro_pabe_932 |
Macaca mulatta | retro_mmul_874 |
Callithrix jacchus | retro_cjac_3303 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017160 | 1 retrocopy | |
Homo sapiens | ENSG00000131368 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011005 | 1 retrocopy |
retro_ggor_880 ,
|
Latimeria chalumnae | ENSLACG00000009006 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005157 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005218 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013409 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000008882 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014658 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000010912 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027997 | 1 retrocopy |