RetrogeneDB ID: | retro_cjac_496 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:201496218..201496543(+) | ||
| Located in intron of: | ENSCJAG00000004636 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | JTB | ||
| Ensembl ID: | ENSCJAG00000009973 | ||
| Aliases: | None | ||
| Description: | jumping translocation breakpoint [Source:HGNC Symbol;Acc:6201] |
| Percent Identity: | 52.21 % |
| Parental protein coverage: | 74.83 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | EKLSAVSTSNLPCWLVGEFVVSEECSPCSSFQAKTTPECGPTGYVEKITCSSSK-RNEFKS-CRSALMEQ |
| ...SA.S......W........E...P.S.F.AKT.PECG.T..VEK.T..SS..RNEFKS....AL... | |
| Retrocopy | DRVSAASVP*EEQWS*APQICVERGTPHSHF*AKTIPECGFTESVEK-TTCSSP>RNEFKS>VCPALTQP |
| Parental | RLFWKFEGAVVCVALIFACLVIIRQRQLDR-KALEKVRKQIES |
| RLFWKFEGAV...ALIF.CLVI..Q.QL...KALE.V..Q.ES | |
| Retrocopy | RLFWKFEGAV-GLALIFDCLVISCQLQLGK<KALENVWRQVES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 9 .61 RPM |
| SRP051959_heart | 0 .19 RPM | 7 .40 RPM |
| SRP051959_kidney | 0 .24 RPM | 12 .69 RPM |
| SRP051959_liver | 0 .09 RPM | 17 .72 RPM |
| SRP051959_lung | 0 .23 RPM | 7 .94 RPM |
| SRP051959_lymph_node | 0 .18 RPM | 9 .31 RPM |
| SRP051959_skeletal_muscle | 0 .17 RPM | 15 .09 RPM |
| SRP051959_spleen | 0 .21 RPM | 11 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_1886 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000002520 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009973 | 1 retrocopy |
retro_cjac_496 ,
|
| Dasypus novemcinctus | ENSDNOG00000000740 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008256 | 1 retrocopy | |
| Felis catus | ENSFCAG00000012590 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013299 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011788 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000003210 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000791 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006559 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012646 | 1 retrocopy |