RetrogeneDB ID: | retro_cjac_988 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 12:78971382..78971724(+) | ||
Located in intron of: | ENSCJAG00000008495 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SDHC | ||
Ensembl ID: | ENSCJAG00000004757 | ||
Aliases: | None | ||
Description: | succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa [Source:HGNC Symbol;Acc:10682] |
Percent Identity: | 87.72 % |
Parental protein coverage: | 67.46 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLYLGPALIHTAKFALVFPLM |
ITIYSWSLP..MSI.HRGTGIAL.AGVSLFG..ALLLPGNFESY.ELVKSL.LGPALIH.AKFALVFPLM | |
Retrocopy | ITIYSWSLPTVMSIYHRGTGIALNAGVSLFGILALLLPGNFESYMELVKSLCLGPALIHAAKFALVFPLM |
Parental | YHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSLGLAAM |
YHTWNGI.HLMWDLGKG.KIP.LYQSGVVVLVLTVLSS..LAAM | |
Retrocopy | YHTWNGICHLMWDLGKGMKIP*LYQSGVVVLVLTVLSSVELAAM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .29 RPM | 21 .63 RPM |
SRP051959_heart | 0 .33 RPM | 32 .13 RPM |
SRP051959_kidney | 0 .44 RPM | 36 .05 RPM |
SRP051959_liver | 0 .35 RPM | 37 .82 RPM |
SRP051959_lung | 0 .44 RPM | 12 .98 RPM |
SRP051959_lymph_node | 0 .53 RPM | 12 .05 RPM |
SRP051959_skeletal_muscle | 0 .35 RPM | 34 .59 RPM |
SRP051959_spleen | 0 .44 RPM | 14 .96 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_609 |
Gorilla gorilla | retro_ggor_536 |
Macaca mulatta | retro_mmul_2416 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies |
retro_cjac_1119, retro_cjac_2455, retro_cjac_988 ,
|
Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
Homo sapiens | ENSG00000143252 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000008017 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000014367 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000001585 | 4 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |