RetrogeneDB ID: | retro_rnor_1487 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:44162621..44163075(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Sdhc | ||
| Ensembl ID: | ENSRNOG00000003163 | ||
| Aliases: | None | ||
| Description: | succinate dehydrogenase complex, subunit C [Source:RefSeq peptide;Acc:NP_001005534] |
| Percent Identity: | 87.5 % |
| Parental protein coverage: | 89.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SSQLCIRNAAPLGTTAKEEMARFWNKNTSSNRPVSPHLTIYRWSLPMAMSVCHRGSGIAMSGG-VSLFGL |
| ..QL.IRNAAPLGTTAKEEMA.FWNKNTSSNRPVSPHLTIYRWSLP.AM.VCHRGSGIA.SGG.VSL.GL | |
| Retrocopy | TTQLRIRNAAPLGTTAKEEMAQFWNKNTSSNRPVSPHLTIYRWSLPTAMPVCHRGSGIALSGG>VSLSGL |
| Parental | SALLLPGNFESYLMLVKSLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLSISQVQLSGVTVLV |
| .ALLLPGNFESYLMLVKSL.LGPALIHAAKFVLVF..MYH.LNGV.HLMWDLGKGL.I.QVQLSG.TV.V | |
| Retrocopy | WALLLPGNFESYLMLVKSLYLGPALIHAAKFVLVFLFMYHTLNGVCHLMWDLGKGLAIPQVQLSGMTVSV |
| Parental | LAVLSSAGLAAI |
| LAVLSSAGLAAI | |
| Retrocopy | LAVLSSAGLAAI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 85 .92 RPM |
| SRP017611_kidney | 0 .00 RPM | 370 .26 RPM |
| SRP017611_liver | 0 .00 RPM | 108 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
| Homo sapiens | ENSG00000143252 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008017 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014367 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000001585 | 4 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies |
retro_rnor_1486, retro_rnor_1487 ,
|
| Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
| Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |