RetrogeneDB ID: | retro_ggor_1390 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 18:67189652..67189995(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SDHC | ||
| Ensembl ID: | ENSGGOG00000008017 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.52 % |
| Parental protein coverage: | 98.28 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ALLLSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELLKSLCLGPALIH-TAKFALVFPL |
| AL...W.LPM.MS.CH.G.GIALSA.V.LFGMS.LLLPGNFESYL.L.KSLCLGPALIH.TA..AL.FPL | |
| Retrocopy | ALSTVWPLPMTMSLCHCGSGIALSARVCLFGMSVLLLPGNFESYLKLVKSLCLGPALIH>TATLALLFPL |
| Parental | MYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSVGLAAM |
| M.HTW.GI..LMW.LG..LKIPQL.QS.VVVLVLTVL.SVGLAAM | |
| Retrocopy | MCHTWSGISPLMWYLGIALKIPQLHQSRVVVLVLTVLWSVGLAAM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .18 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 8 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 35 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 18 .94 RPM |
| SRP007412_testis | 0 .10 RPM | 12 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
| Homo sapiens | ENSG00000143252 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008017 | 3 retrocopies |
retro_ggor_1390 , retro_ggor_536, retro_ggor_697,
|
| Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014367 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
| Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |