RetrogeneDB ID: | retro_ptro_449 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 10:91658427..91658664(+) | ||
Located in intron of: | ENSPTRG00000002753 | ||
Retrocopyinformation | Ensembl ID: | ENSPTRG00000042284 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SDHC | ||
Ensembl ID: | ENSPTRG00000001585 | ||
Aliases: | None | ||
Description: | succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa [Source:HGNC Symbol;Acc:10682] |
Percent Identity: | 88.61 % |
Parental protein coverage: | 52.67 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICH |
AALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAK.EMERFWNKN.G.NRP.SPH.TIYSWSLPMAM.ICH | |
Retrocopy | AALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKQEMERFWNKNTGLNRPVSPHVTIYSWSLPMAMAICH |
Parental | RGTGIALSA |
R.TG.AL.A | |
Retrocopy | RDTGTALRA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .80 RPM | 52 .62 RPM |
SRP007412_cerebellum | 0 .43 RPM | 39 .54 RPM |
SRP007412_heart | 0 .15 RPM | 90 .53 RPM |
SRP007412_kidney | 0 .58 RPM | 137 .85 RPM |
SRP007412_liver | 0 .43 RPM | 52 .15 RPM |
SRP007412_testis | 0 .21 RPM | 26 .14 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001585 | 4 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |