RetrogeneDB ID: | retro_cpor_760 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_263:236219..236500(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000009834 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.5 % |
Parental protein coverage: | 59.87 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | AAIGSFQFGYNTGVINAPEMITTEFINSTLSQKLGNPPSKE-LLTTLWSLSVAIFSVGGM-LGSFSIGLS |
.AI.SFQF..NTG.IN.P.MI.T.F.NSTLSQKL.NPP....LLT.L..LS.AI.SVGGM.L..F....S | |
Retrocopy | SAINSFQFRCNTGIINSPKMIITKFLNSTLSQKLDNPPRNR>LLTIL*HLSLAICSVGGM>LALFPLD-S |
Parental | VNHFGRRNSMLMVNVLVVVSGCLMGF |
...FGR.NSMLMVN.LV...GC.MGF | |
Retrocopy | ASRFGRQNSMLMVNILVMANGCFMGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
SRP040447_lung | 0 .00 RPM | 0 .03 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004556 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000018988 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000003074 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009834 | 1 retrocopy |
retro_cpor_760 ,
|
Cavia porcellus | ENSCPOG00000011295 | 1 retrocopy | |
Felis catus | ENSFCAG00000001625 | 1 retrocopy | |
Homo sapiens | ENSG00000059804 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016813 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000439 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026903 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008575 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004234 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004235 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004624 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004626 | 1 retrocopy |