RetrogeneDB ID: | retro_dnov_1033 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_138252:3885..4194(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC59 | ||
Ensembl ID: | ENSDNOG00000011546 | ||
Aliases: | None | ||
Description: | coiled-coil domain containing 59 [Source:HGNC Symbol;Acc:25005] |
Percent Identity: | 55.56 % |
Parental protein coverage: | 53. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | SEEQCSIDRTLPAEQCSKTVNSTAISKKNKKKTSNQKAQEEYEQVQA-KRAAKKQEFERRKRE-REESQR |
SEEQ...D..LP...CS......A.....KKK.SNQKA..EYEQ.QA.K.AAKK.E.ERRKR..R.E... | |
Retrocopy | SEEQ--VDQPLPQVPCSTDQPLPAGKHIEKKKISNQKA*DEYEQAQA<KLAAKK-ELERRKRN>RSEVPX |
Parental | LYKKKKMEMFKILSKKTKKGQPNLNLQMEYLLQKIQEK |
.......E.FK.L.KKT.KGQ.NL.LQMEYLL.K.QEK | |
Retrocopy | XXXXXXXEVFKVLCKKTEKGQLNLTLQMEYLLPKVQEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 16 .72 RPM |
SRP012922_cerebellum | 0 .00 RPM | 20 .76 RPM |
SRP012922_heart | 0 .00 RPM | 8 .59 RPM |
SRP012922_kidney | 0 .00 RPM | 18 .34 RPM |
SRP012922_liver | 0 .00 RPM | 7 .90 RPM |
SRP012922_lung | 0 .00 RPM | 27 .49 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 8 .13 RPM |
SRP012922_spleen | 0 .00 RPM | 23 .58 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016875 | 1 retrocopy | |
Bos taurus | ENSBTAG00000036282 | 4 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000007788 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000011546 | 1 retrocopy |
retro_dnov_1033 ,
|
Dipodomys ordii | ENSDORG00000003005 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000256 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025296 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000000967 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017824 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000004383 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005266 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000008887 | 7 retrocopies |